PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0052000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 584aa    MW: 63517.6 Da    PI: 6.1502
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0052000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-083954321954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA++++Lt +qV++WF N R +
  Spipo2G0052000 395 FEHflHPYPKDSDKLMLARQTRLTRSQVSNWFINARVR 432
                     664459******************************88 PP

2BELL114.84.5e-37255326172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er++lq+k ++L+s+++eVd++Y++y++q+q+v+ssF+av+g gsak Yt lAl++iSrhFr+L+dai++qi
  Spipo2G0052000 255 EREDLQNKMSRLMSMQDEVDRKYRHYHHQMQIVVSSFDAVVGSGSAKTYTGLALQTISRHFRSLRDAISGQI 326
                     789********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-53185324IPR006563POX domain
PfamPF075262.2E-45191323IPR006563POX domain
PROSITE profilePS5007111.969373436IPR001356Homeobox domain
SMARTSM003899.8E-9376440IPR001356Homeobox domain
CDDcd000864.63E-12376437No hitNo description
SuperFamilySSF466891.45E-16377444IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27379442IPR009057Homeodomain-like
PfamPF059202.8E-17393432IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MATTVHQKDP GHAPYQEFSL PGGILYSENP APSSYPDSMV YYPRLQHVSG ELPVHGGGMS  60
QEEPSVGRSE LISPRTGEIP FDAWKMARNE LFFMQTVGGG AASLHGSMAD GRNPPLDPSS  120
ISGIGGQGLS LSLGTELPVP SFHYRPSSEI SFAASHQPSA ENALPGRDDH SRDKGVAEAA  180
PYGVQNLVVT VSGSRYLQAA QHLLDEVVNV HGALKNSTSE RGQSSLGTSG RREGDCRPKG  240
EEPPANPAPE LSAAEREDLQ NKMSRLMSMQ DEVDRKYRHY HHQMQIVVSS FDAVVGSGSA  300
KTYTGLALQT ISRHFRSLRD AISGQISATR RSLGEQDPLS ARAGGMARLR CIDQQIRDQR  360
AFQQFGSLQQ PPQQAWRPQR GLPESSVSIL RAWLFEHFLH PYPKDSDKLM LARQTRLTRS  420
QVSNWFINAR VRLWKPMIEE MYEEELRDAE MNSNSLDGDG ARGNAARSSE PADENAVVAG  480
SSSVGKPQPF TDHCDLLQEE ALAQTDVNSR YMVYEMAGLG GGTAGGSVSL TLGLQHSDGG  540
PHAPAADQRF APIEGDAADY DCLNIVDRRH RFGSIPLLHD FVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B7e-16382439158Homeobox protein Meis1
4xrs_A7e-16382439158Homeobox protein Meis1
5bng_A8e-16382440159Homeobox protein Meis2
5bng_B8e-16382440159Homeobox protein Meis2
4xrm_B8e-16382440563Homeobox protein Meis2
4xrm_A8e-16382440563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932911.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLM0U2B71e-166M0U2B7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P21580_0011e-166(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.13e-97BEL1-like homeodomain 7